PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016476240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 399aa    MW: 46517.3 Da    PI: 9.045
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016476240.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.93.1e-121896998
                    HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  9 dvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                      +k++ l +p  f+ ++  g++   +++  +  + +++W+vk+  ++++    ++ GW +F+++++L+ gD ++F+++g++ f   v +f+
  XP_016476240.1 18 PGFKHA-LKIPTGFL-KYlkGYD---HIEHAILRRGSKQWRVKV--NGCR----FEVGWADFAQQHDLQLGDLLIFRHEGNMVF--EVIIFD 96
                    455555.9*******.6655444...5677888999********..7777....999*********************999999..777776 PP

2B351.71.6e-16140225493
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                      +++s++l++g +++p +fa+++g++ ++  +l+++de+ rsW++kl    + +++++++ W +F  an+Lk+gD + F+++ + ++++ 
  XP_016476240.1 140 CTVRSYYLTNGYMRVPSRFASKNGLIYKK-CDLIIRDERQRSWNLKL--YTSCDHVYIGGRWAKFHAANDLKVGDRIKFEVVTN-GERPI 225
                     5678*******************998655.59***************..99999**************************8764.44455 PP

3B343.36.4e-14298384595
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +++++ l+ + l+lp +fa ++g+++ ++ +l+++de+ rsW++ l  r  + ++ +++GW++  + + LkegD ++F+++  +++++v k
  XP_016476240.1 298 TIRPYCLTYSYLILPTQFALTNGLIN-KKYDLIIRDEWQRSWNLML--RPFGTSVCIRGGWSKLRDTHCLKEGDQIMFEVVT-DGTKPVWK 384
                     56788999999***********9995.668****************..*******************************876.56656655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.3E-185100IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-197100IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.152998IPR003340B3 DNA binding domain
CDDcd100174.53E-131096No hitNo description
SMARTSM010194.0E-111298IPR003340B3 DNA binding domain
PfamPF023627.7E-92096IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-16135229IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-17136229IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.491137231IPR003340B3 DNA binding domain
SMARTSM010197.1E-9138232IPR003340B3 DNA binding domain
PfamPF023629.7E-15141227IPR003340B3 DNA binding domain
CDDcd100172.67E-13143216No hitNo description
Gene3DG3DSA:2.40.330.102.2E-14291385IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.79E-16293386IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.743294388IPR003340B3 DNA binding domain
SMARTSM010198.9E-12295389IPR003340B3 DNA binding domain
PfamPF023627.0E-12298384IPR003340B3 DNA binding domain
CDDcd100177.65E-11309382No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MKEKVRPAKP HFFKPIQPGF KHALKIPTGF LKYLKGYDHI EHAILRRGSK QWRVKVNGCR  60
FEVGWADFAQ QHDLQLGDLL IFRHEGNMVF EVIIFDSSHC DREYAEYLLQ EEDIVEEACK  120
KFKFKEAATH NPFGQSHFEC TVRSYYLTNG YMRVPSRFAS KNGLIYKKCD LIIRDERQRS  180
WNLKLYTSCD HVYIGGRWAK FHAANDLKVG DRIKFEVVTN GERPIWKFHD SGHCNREYAE  240
YLQEKEEEKE EAAGDAVEGT SKKFKLKEEP NPSVKSSSKA FPHVEAAIHK PFGHFVCTIR  300
PYCLTYSYLI LPTQFALTNG LINKKYDLII RDEWQRSWNL MLRPFGTSVC IRGGWSKLRD  360
THCLKEGDQI MFEVVTDGTK PVWKFHGKIS GECKNQSRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016476240.10.0PREDICTED: B3 domain-containing protein REM5-like isoform X3
TrEMBLK4CIB31e-132K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.11e-131(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.19e-40B3 family protein